Glyma09g28730 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma09g28730

Feature Type:	gene_model
Chromosome:	Gm09
Start:	35644004
stop:	35645001
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma09g28730

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
PF00228	PFAM	Bowman-Birk serine protease inhibitor family	JGI		ISS
UniRef100_I1L3Q3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L3Q3_SOYBN	SoyBase	E_val: 1.00E-79	ISS
UniRef100_Q8RU24	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Bowman-Birk type proteinase isoinhibitor A1 n=1 Tax=Glycine soja RepID=Q8RU24_GLYSO	SoyBase	E_val: 4.00E-79	ISS

Expression Patterns of Glyma09g28730

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma09g28730 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.09g158900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma09g28730

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma09g28730

Limit To All Plant Sequences

>Glyma09g28730.1   sequence type=CDS   gene model=Glyma09g28730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTTTGAAGAACAACATGGTGGTGCTAAAGGTGTGTTTGGTGCTACTTTTCCTTGTGGGGGGTACTACTAGTGCCAACTTGAGGCTGAGTAAGCTTGGCCTGCTCATGAAAAGTGATCATCATCAACACTCAAATGATGATGAGTCTTCAAAACCATGCTGTGATCAATGCGCATGCACAAAGTCAAACCCTCCTCAATGCCGCTGTTCAGATATGAGGCTGAATTCGTGCCATTCAGCTTGCAAATCTTGTATTTGCGCATTATCGTATCCTGCACAGTGTTTTTGTGTTGACATAACCGATTTCTGCTATGAACCTTGCAAACCCAGTGAGGATGACAAGGAAAACTACTAA

Predicted protein sequences of Glyma09g28730

Limit To All Plant Sequences

>Glyma09g28730.1   sequence type=predicted peptide   gene model=Glyma09g28730   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGLKNNMVVLKVCLVLLFLVGGTTSANLRLSKLGLLMKSDHHQHSNDDESSKPCCDQCACTKSNPPQCRCSDMRLNSCHSACKSCICALSYPAQCFCVDITDFCYEPCKPSEDDKENY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain